SCOP 1.75: Domain d1tcra1: 1tcr A:1-117

Lineage for d1tcra1 (1tcr A:1-117)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (21 PDB entries)

8. Domain d1tcra1: 1tcr A:1-117 [20605]
   Other proteins in same PDB: d1tcra2, d1tcrb2
   complexed with fuc, man, nag, so4

Details for d1tcra1

PDB Entry: 1tcr, 2.5 Å

PDB Description: murine t-cell antigen receptor 2c clone

PDB Compounds: (A:) alpha, beta T-cell receptor (vb8.2db2jb2.4cb2;va3ja58ca)

SCOP Domain Sequences for d1tcra1:

Sequence; same for both SEQRES and ATOM records:

>d1tcra1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqglqlllkyysgdpvvqgvn
gfeaefsksnssfhlrkasvhwsdsavyfcavsgfasaltfgsgtkvivlpy

Timeline for d1tcra1:

• d1tcra1 first appeared (with stable ids) in SCOP 1.55
  
• d1tcra1 appears in SCOP 1.73
  
• d1tcra1 appears in SCOPe 2.01
  
• d1tcra1 appears in the current release, SCOPe 2.08