SCOPe 2.05: Domain d1b6db1: 1b6d B:1-107

Lineage for d1b6db1 (1b6d B:1-107)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (19 PDB entries)

8. Domain d1b6db1: 1b6d B:1-107 [20604]
   Other proteins in same PDB: d1b6da2, d1b6db2
   part of Bence-Jones protein DEL

Details for d1b6db1

PDB Entry: 1b6d, 2.74 Å

PDB Description: bence jones protein del: an entire immunoglobulin kappa light-chain dimer

PDB Compounds: (B:) immunoglobulin

SCOPe Domain Sequences for d1b6db1:

Sequence; same for both SEQRES and ATOM records:

>d1b6db1 b.1.1.1 (B:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcqasqdissylnwyqqkpgkapkllihaassletgvps
rfsgsgsgtdfsftisslqpedlatyycqqydslpltfgggtkveik

Timeline for d1b6db1:

• d1b6db1 first appeared (with stable ids) in SCOP 1.55
  
• d1b6db1 appears in SCOPe 2.04
  
• d1b6db1 appears in SCOPe 2.06
  
• d1b6db1 appears in the current release, SCOPe 2.08