Lineage for d1b6db1 (1b6d B:1-107)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 451612Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 451663Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (19 PDB entries)
  8. 451691Domain d1b6db1: 1b6d B:1-107 [20604]
    Other proteins in same PDB: d1b6da2, d1b6db2
    part of Bence-Jones protein DEL

Details for d1b6db1

PDB Entry: 1b6d (more details), 2.74 Å

PDB Description: bence jones protein del: an entire immunoglobulin kappa light-chain dimer

SCOP Domain Sequences for d1b6db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6db1 b.1.1.1 (B:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1}
diqmtqspsslsasvgdrvtitcqasqdissylnwyqqkpgkapkllihaassletgvps
rfsgsgsgtdfsftisslqpedlatyycqqydslpltfgggtkveik

SCOP Domain Coordinates for d1b6db1:

Click to download the PDB-style file with coordinates for d1b6db1.
(The format of our PDB-style files is described here.)

Timeline for d1b6db1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b6db2