SCOP 1.75: Domain d1mcwm1: 1mcw M:1-111

Lineage for d1mcwm1 (1mcw M:1-111)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Human (Homo sapiens), cluster 4 [TaxId:9606] [88539] (23 PDB entries)

8. Domain d1mcwm1: 1mcw M:1-111 [20601]
   Other proteins in same PDB: d1mcwm2, d1mcww2
   part of heterologous L chain dimer MCG-WEIR

Details for d1mcwm1

PDB Entry: 1mcw, 3.5 Å

PDB Description: three-dimensional structure of a hybrid light chain dimer. protein engineering of a binding cavity

PDB Compounds: (M:) immunoglobulin mcg (light chain)

SCOP Domain Sequences for d1mcwm1:

Sequence; same for both SEQRES and ATOM records:

>d1mcwm1 b.1.1.1 (M:1-111) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]}
esaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlg

Timeline for d1mcwm1:

• d1mcwm1 first appeared (with stable ids) in SCOP 1.55
  
• d1mcwm1 appears in SCOP 1.73
  
• d1mcwm1 appears in SCOPe 2.01
  
• d1mcwm1 appears in the current release, SCOPe 2.08