SCOPe 2.07: Domain d2r2ha1: 2r2h A:1-107

Lineage for d2r2ha1 (2r2h A:1-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (51 PDB entries)

8. Domain d2r2ha1: 2r2h A:1-107 [205950]
   Other proteins in same PDB: d2r2ha2, d2r2hb1, d2r2hb2
   automated match to d3t65a1
   complexed with ko2, mg, zn

Details for d2r2ha1

PDB Entry: 2r2h, 2 Å

PDB Description: structure of s25-2 in complex with ko

PDB Compounds: (A:) Fab, antibody fragment (IgG1k), light chain

SCOPe Domain Sequences for d2r2ha1:

Sequence; same for both SEQRES and ATOM records:

>d2r2ha1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltitsvqaedlavyyckqsynlrtfgggtkleikr

Timeline for d2r2ha1:

• d2r2ha1 first appeared in SCOPe 2.03
  
• d2r2ha1 appears in SCOPe 2.06
  
• d2r2ha1 appears in the current release, SCOPe 2.08