Lineage for d2r2ea1 (2r2e A:1-107)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2353665Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2354061Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (51 PDB entries)
  8. 2354108Domain d2r2ea1: 2r2e A:1-107 [205946]
    Other proteins in same PDB: d2r2ea2, d2r2eb1, d2r2eb2
    automated match to d3t65a1
    complexed with kde

Details for d2r2ea1

PDB Entry: 2r2e (more details), 2.4 Å

PDB Description: crystal structure of s25-2 fab in complex with kdo analogues
PDB Compounds: (A:) Fab, antibody fragment (IgG1k), light chain

SCOPe Domain Sequences for d2r2ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r2ea1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltitsvqaedlavyyckqsynlrtfgggtkleikr

SCOPe Domain Coordinates for d2r2ea1:

Click to download the PDB-style file with coordinates for d2r2ea1.
(The format of our PDB-style files is described here.)

Timeline for d2r2ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r2ea2