SCOPe 2.05: Domain d2r1xa1: 2r1x A:1-107

Lineage for d2r1xa1 (2r1x A:1-107)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (46 PDB entries)

8. Domain d2r1xa1: 2r1x A:1-107 [205930]
   Other proteins in same PDB: d2r1xa2, d2r1xb1, d2r1xb2
   automated match to d3t65a1
   complexed with kda, kdd, mg, zn

Details for d2r1xa1

PDB Entry: 2r1x, 1.6 Å

PDB Description: crystal structure of s25-2 fab in complex with kdo analogues

PDB Compounds: (A:) Fab, antibody fragment (IgG1k), light chain

SCOPe Domain Sequences for d2r1xa1:

Sequence; same for both SEQRES and ATOM records:

>d2r1xa1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltitsvqaedlavyyckqsynlrtfgggtkleikr

Timeline for d2r1xa1:

• d2r1xa1 first appeared in SCOPe 2.03
  
• d2r1xa1 appears in SCOPe 2.04
  
• d2r1xa1 appears in SCOPe 2.06
  
• d2r1xa1 appears in the current release, SCOPe 2.08