SCOPe 2.05: Domain d2r0ob1: 2r0o B:44-160

Lineage for d2r0ob1 (2r0o B:44-160)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.0: automated matches [227151] (1 protein)
   not a true family

6. Protein automated matches [226856] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224978] (26 PDB entries)

8. Domain d2r0ob1: 2r0o B:44-160 [205922]
   automated match to d1sh5a1
   complexed with gol; mutant

Details for d2r0ob1

PDB Entry: 2r0o, 2.2 Å

PDB Description: crystal structure of the actin-binding domain of human alpha-actinin-4 mutant(k255e)

PDB Compounds: (B:) Alpha-actinin-4

SCOPe Domain Sequences for d2r0ob1:

Sequence; same for both SEQRES and ATOM records:

>d2r0ob1 a.40.1.0 (B:44-160) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pefawekqqrktftawcnshlrkagtqienidedfrdglklmlllevisgerlpkpergk
mrvhkinnvnkaldfiaskgvklvsigaeeivdgnakmtlgmiwtiilrfaiqdisv

Timeline for d2r0ob1:

• d2r0ob1 first appeared in SCOPe 2.03
  
• d2r0ob1 appears in SCOPe 2.04
  
• d2r0ob1 appears in SCOPe 2.06
  
• d2r0ob1 appears in the current release, SCOPe 2.08