Lineage for d2r0oa2 (2r0o A:161-272)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1491007Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 1491008Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 1491085Family a.40.1.0: automated matches [227151] (1 protein)
    not a true family
  6. 1491086Protein automated matches [226856] (2 species)
    not a true protein
  7. 1491087Species Human (Homo sapiens) [TaxId:9606] [224978] (24 PDB entries)
  8. 1491103Domain d2r0oa2: 2r0o A:161-272 [205921]
    automated match to d1sh5a2
    complexed with gol; mutant

Details for d2r0oa2

PDB Entry: 2r0o (more details), 2.2 Å

PDB Description: crystal structure of the actin-binding domain of human alpha-actinin-4 mutant(k255e)
PDB Compounds: (A:) Alpha-actinin-4

SCOPe Domain Sequences for d2r0oa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r0oa2 a.40.1.0 (A:161-272) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eetsakeglllwcqrktapyknvnvqnfhiswkdglafnalihrhrpelieydklrkddp
vtnlnnafevaekyldipkmldaedivntarpdeeaimtyvssfyhafsgal

SCOPe Domain Coordinates for d2r0oa2:

Click to download the PDB-style file with coordinates for d2r0oa2.
(The format of our PDB-style files is described here.)

Timeline for d2r0oa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r0oa1