SCOPe 2.06: Domain d2qzjb_: 2qzj B:

Lineage for d2qzjb_ (2qzj B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (71 species)
   not a true protein

7. Species Clostridium difficile [TaxId:272563] [225325] (1 PDB entry)

8. Domain d2qzjb_: 2qzj B: [205911]
   automated match to d2iynb_

Details for d2qzjb_

PDB Entry: 2qzj, 2.89 Å

PDB Description: crystal structure of a two-component response regulator from clostridium difficile

PDB Compounds: (B:) Two-component response regulator

SCOPe Domain Sequences for d2qzjb_:

Sequence; same for both SEQRES and ATOM records:

>d2qzjb_ c.23.1.0 (B:) automated matches {Clostridium difficile [TaxId: 272563]}
qtkiliidgdkdncqklkgfleekgisidlaynceeaigkifsnkydlifleiilsdgdg
wtlckkirnvttcpivymtyinedqsilnalnsggddylikplnleilyakvkailrrmn
s

Timeline for d2qzjb_:

• d2qzjb_ first appeared in SCOPe 2.03
  
• d2qzjb_ appears in SCOPe 2.05
  
• d2qzjb_ appears in SCOPe 2.07
  
• d2qzjb_ appears in the current release, SCOPe 2.08