Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (59 species) not a true protein |
Species Clostridium difficile [TaxId:272563] [225325] (1 PDB entry) |
Domain d2qzjb_: 2qzj B: [205911] automated match to d2iynb_ |
PDB Entry: 2qzj (more details), 2.89 Å
SCOPe Domain Sequences for d2qzjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qzjb_ c.23.1.0 (B:) automated matches {Clostridium difficile [TaxId: 272563]} qtkiliidgdkdncqklkgfleekgisidlaynceeaigkifsnkydlifleiilsdgdg wtlckkirnvttcpivymtyinedqsilnalnsggddylikplnleilyakvkailrrmn s
Timeline for d2qzjb_: