SCOPe 2.04: Domain d2qzja_: 2qzj A:

Lineage for d2qzja_ (2qzj A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (54 species)
   not a true protein

7. Species Clostridium difficile [TaxId:272563] [225325] (1 PDB entry)

8. Domain d2qzja_: 2qzj A: [205910]
   automated match to d2iynb_

Details for d2qzja_

PDB Entry: 2qzj, 2.89 Å

PDB Description: crystal structure of a two-component response regulator from clostridium difficile

PDB Compounds: (A:) Two-component response regulator

SCOPe Domain Sequences for d2qzja_:

Sequence; same for both SEQRES and ATOM records:

>d2qzja_ c.23.1.0 (A:) automated matches {Clostridium difficile [TaxId: 272563]}
qtkiliidgdkdncqklkgfleekgisidlaynceeaigkifsnkydlifleiilsdgdg
wtlckkirnvttcpivymtyinedqsilnalnsggddylikplnleilyakvkailrrmn
s

Timeline for d2qzja_:

• d2qzja_ first appeared in SCOPe 2.03
  
• d2qzja_ appears in SCOPe 2.05
  
• d2qzja_ appears in the current release, SCOPe 2.08