Lineage for d1mcna1 (1mcn A:1-111)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289510Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 1289545Species Human (Homo sapiens), cluster 4 [TaxId:9606] [88539] (23 PDB entries)
  8. 1289578Domain d1mcna1: 1mcn A:1-111 [20591]
    Other proteins in same PDB: d1mcna2, d1mcnb2
    part of the antibody MCG light chain dimer

Details for d1mcna1

PDB Entry: 1mcn (more details), 2.7 Å

PDB Description: principles and pitfalls in designing site directed peptide ligands
PDB Compounds: (A:) immunoglobulin lambda dimer mcg (light chain)

SCOPe Domain Sequences for d1mcna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mcna1 b.1.1.1 (A:1-111) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]}
psaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlg

SCOPe Domain Coordinates for d1mcna1:

Click to download the PDB-style file with coordinates for d1mcna1.
(The format of our PDB-style files is described here.)

Timeline for d1mcna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mcna2