SCOPe 2.04: Domain d2qycb_: 2qyc B:

Lineage for d2qycb_ (2qyc B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (19 species)
   not a true protein

7. Species Bordetella bronchiseptica [TaxId:257310] [225323] (1 PDB entry)

8. Domain d2qycb_: 2qyc B: [205899]
   automated match to d1q4ra_
   complexed with act, cl, edo

Details for d2qycb_

PDB Entry: 2qyc, 1.9 Å

PDB Description: crystal structure of a dimeric ferredoxin-like protein (bb1511) from bordetella bronchiseptica rb50 at 1.90 a resolution

PDB Compounds: (B:) Ferredoxin-like protein

SCOPe Domain Sequences for d2qycb_:

Sequence; same for both SEQRES and ATOM records:

>d2qycb_ d.58.4.0 (B:) automated matches {Bordetella bronchiseptica [TaxId: 257310]}
gmtmflhvvmmefddgidagffrtvdeyvarmkrecdglllyhfgenvaarsqgythats
safvdaaahdayqvcpahvamkafmgprikrvvvydgevpai

Timeline for d2qycb_:

• d2qycb_ first appeared in SCOPe 2.03
  
• d2qycb_ appears in SCOPe 2.05
  
• d2qycb_ appears in the current release, SCOPe 2.08, called d2qycb1