Lineage for d2qtec_ (2qte C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766530Species Ictalurus punctatus [TaxId:7998] [225469] (6 PDB entries)
  8. 1766543Domain d2qtec_: 2qte C: [205885]
    automated match to d2apva_
    mutant

Details for d2qtec_

PDB Entry: 2qte (more details), 1.9 Å

PDB Description: crystal structure of novel immune-type receptor 11 extracellular fragment mutant n30d
PDB Compounds: (C:) Novel immune-type receptor 11

SCOPe Domain Sequences for d2qtec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qtec_ b.1.1.0 (C:) automated matches {Ictalurus punctatus [TaxId: 7998]}
ikelhvktvkrgenvtmecsmskvtnkdnlawyrqsfgkvpqyfvryyssnsgykfaegf
kdsrfsmtvndqkfdlniigareddggeyfcgevegiiikftsgtrlqf

SCOPe Domain Coordinates for d2qtec_:

Click to download the PDB-style file with coordinates for d2qtec_.
(The format of our PDB-style files is described here.)

Timeline for d2qtec_: