SCOPe 2.05: Domain d2qtea_: 2qte A:

Lineage for d2qtea_ (2qte A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Ictalurus punctatus [TaxId:7998] [225469] (6 PDB entries)

8. Domain d2qtea_: 2qte A: [205883]
   automated match to d2apva_
   mutant

Details for d2qtea_

PDB Entry: 2qte, 1.9 Å

PDB Description: crystal structure of novel immune-type receptor 11 extracellular fragment mutant n30d

PDB Compounds: (A:) Novel immune-type receptor 11

SCOPe Domain Sequences for d2qtea_:

Sequence; same for both SEQRES and ATOM records:

>d2qtea_ b.1.1.0 (A:) automated matches {Ictalurus punctatus [TaxId: 7998]}
ikelhvktvkrgenvtmecsmskvtnkdnlawyrqsfgkvpqyfvryyssnsgykfaegf
kdsrfsmtvndqkfdlniigareddggeyfcgevegiiikftsgtrlqf

Timeline for d2qtea_:

• d2qtea_ first appeared in SCOPe 2.03
  
• d2qtea_ appears in SCOPe 2.04
  
• d2qtea_ appears in SCOPe 2.06
  
• d2qtea_ appears in the current release, SCOPe 2.08