Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (46 species) not a true protein |
Species Geobacillus kaustophilus [TaxId:1462] [187671] (2 PDB entries) |
Domain d2qq3l_: 2qq3 L: [205867] automated match to d3moya_ complexed with edo |
PDB Entry: 2qq3 (more details), 1.95 Å
SCOPe Domain Sequences for d2qq3l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qq3l_ c.14.1.0 (L:) automated matches {Geobacillus kaustophilus [TaxId: 1462]} sefvsiaarqegavgiielarpdvlnalsrqmvaeivaaveafdrnekvrvivltgrgra faagadiqemakddpirlewlnqfadwdrlsivktpmiaavnglalgggfelalscdliv assaaefgfpevnlgvmpgaggtqrltkligpkralewlwtgarmsakeaeqlgivnrvv spellmeetmrlagrlaeqpplalrlikeavqkavdyplyegmqferknfyllfasedqk egmaaflekrkprfqgk
Timeline for d2qq3l_: