SCOPe 2.08: Domain d1mcsb1: 1mcs B:2-111

Lineage for d1mcsb1 (1mcs B:2-111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Human (Homo sapiens), cluster 4 [TaxId:9606] [88539] (23 PDB entries)

8. Domain d1mcsb1: 1mcs B:2-111 [20586]
   Other proteins in same PDB: d1mcsa2, d1mcsa3, d1mcsb2, d1mcsb3
   part of the antibody MCG light chain dimer

Details for d1mcsb1

PDB Entry: 1mcs, 2.7 Å

PDB Description: principles and pitfalls in designing site directed peptide ligands

PDB Compounds: (B:) immunoglobulin lambda dimer mcg (light chain)

SCOPe Domain Sequences for d1mcsb1:

Sequence; same for both SEQRES and ATOM records:

>d1mcsb1 b.1.1.1 (B:2-111) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]}
saltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgvp
drfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlg

Timeline for d1mcsb1:

• d1mcsb1 first appeared (with stable ids) in SCOP 1.55
  
• d1mcsb1 appears in SCOPe 2.07