Lineage for d1mcsa1 (1mcs A:1-111)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2354589Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 2354621Species Human (Homo sapiens), cluster 4 [TaxId:9606] [88539] (23 PDB entries)
  8. 2354660Domain d1mcsa1: 1mcs A:1-111 [20585]
    Other proteins in same PDB: d1mcsa2, d1mcsb2
    part of the antibody MCG light chain dimer

Details for d1mcsa1

PDB Entry: 1mcs (more details), 2.7 Å

PDB Description: principles and pitfalls in designing site directed peptide ligands
PDB Compounds: (A:) immunoglobulin lambda dimer mcg (light chain)

SCOPe Domain Sequences for d1mcsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mcsa1 b.1.1.1 (A:1-111) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]}
psaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlg

SCOPe Domain Coordinates for d1mcsa1:

Click to download the PDB-style file with coordinates for d1mcsa1.
(The format of our PDB-style files is described here.)

Timeline for d1mcsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mcsa2