Lineage for d1mcsa1 (1mcs A:1-111)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52667Species Lambda L chain dimer MCG (human) [48930] (18 PDB entries)
  8. 52688Domain d1mcsa1: 1mcs A:1-111 [20585]
    Other proteins in same PDB: d1mcsa2, d1mcsb2

Details for d1mcsa1

PDB Entry: 1mcs (more details), 2.7 Å

PDB Description: principles and pitfalls in designing site directed peptide ligands

SCOP Domain Sequences for d1mcsa1:

Sequence, based on SEQRES records: (download)

>d1mcsa1 b.1.1.1 (A:1-111) Immunoglobulin (variable domains of L and H chains) {Lambda L chain dimer MCG (human)}
esaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlg

Sequence, based on observed residues (ATOM records): (download)

>d1mcsa1 b.1.1.1 (A:1-111) Immunoglobulin (variable domains of L and H chains) {Lambda L chain dimer MCG (human)}
psaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlg

SCOP Domain Coordinates for d1mcsa1:

Click to download the PDB-style file with coordinates for d1mcsa1.
(The format of our PDB-style files is described here.)

Timeline for d1mcsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mcsa2