Lineage for d2qn0a1 (2qn0 A:2-427)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2530179Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2530180Protein automated matches [190805] (17 species)
    not a true protein
  7. 2530187Species Clostridium botulinum [TaxId:1491] [193827] (7 PDB entries)
  8. 2530189Domain d2qn0a1: 2qn0 A:2-427 [205849]
    Other proteins in same PDB: d2qn0a2
    automated match to d2fpqa_
    complexed with zn

Details for d2qn0a1

PDB Entry: 2qn0 (more details), 1.75 Å

PDB Description: Structure of Botulinum neurotoxin serotype C1 light chain protease
PDB Compounds: (A:) Neurotoxin

SCOPe Domain Sequences for d2qn0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qn0a1 d.92.1.0 (A:2-427) automated matches {Clostridium botulinum [TaxId: 1491]}
pitinnfnysdpvdnknilyldthlntlanepekafritgniwvipdrfsrnsnpnlnkp
prvtspksgyydpnylstdsdkdtflkeiiklfkrinsreigeeliyrlstdipfpgnnn
tpintfdfdvdfnsvdvktrqgnnwvktgsinpsviitgpreniidpetstfkltnntfa
aqegfgalsiisisprfmltysnatndvgegrfsksefcmdpililmhelnhamhnlygi
aipndqtissvtsnifysqynvkleyaeiyafggptidlipksarkyfeekaldyyrsia
krlnsittanpssfnkyigeykqklirkyrfvvessgevtvnrnkfvelyneltqiftef
nyakiynvqnrkiylsnvytpvtanilddnvydiqngfnipksnlnvlfmgqnlsrnpal
rkvnpe

SCOPe Domain Coordinates for d2qn0a1:

Click to download the PDB-style file with coordinates for d2qn0a1.
(The format of our PDB-style files is described here.)

Timeline for d2qn0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qn0a2