SCOPe 2.04: Domain d2qkba_: 2qkb A:

Lineage for d2qkba_ (2qkb A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225370] (2 PDB entries)

8. Domain d2qkba_: 2qkb A: [205833]
   automated match to d2zqba_
   protein/DNA complex; protein/RNA complex; complexed with edo, so4; mutant

Details for d2qkba_

PDB Entry: 2qkb, 2.4 Å

PDB Description: human rnase h catalytic domain mutant d210n in complex with 20-mer rna/dna hybrid

PDB Compounds: (A:) Ribonuclease H1

SCOPe Domain Sequences for d2qkba_:

Sequence; same for both SEQRES and ATOM records:

>d2qkba_ c.55.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshmgdfvvvytdgccssngrrrpragigvywgpghplnvgirlpgrqtnqraeihaack
aieqaktqninklvlytnsmftingitnwvqgwkkngwktsagkevinkedfvalerltq
gmdiqwmhvpghsgfigneeadrlaregakqs

Timeline for d2qkba_:

• d2qkba_ first appeared in SCOPe 2.03
  
• d2qkba_ appears in SCOPe 2.05
  
• d2qkba_ appears in the current release, SCOPe 2.08, called d2qkba1