Lineage for d2qgga2 (2qgg A:104-181)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1790502Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 1790503Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 1790645Family b.41.1.0: automated matches [227212] (1 protein)
    not a true family
  6. 1790646Protein automated matches [226947] (2 species)
    not a true protein
  7. 1790647Species Acinetobacter calcoaceticus [TaxId:471] [225297] (1 PDB entry)
  8. 1790648Domain d2qgga2: 2qgg A:104-181 [205811]
    Other proteins in same PDB: d2qgga1
    automated match to d2f1la1
    complexed with k, unl

Details for d2qgga2

PDB Entry: 2qgg (more details), 2.4 Å

PDB Description: x-ray structure of the protein q6f7i0 from acinetobacter calcoaceticus amms 248. northeast structural genomics consortium target asr73.
PDB Compounds: (A:) 16S rRNA-processing protein rimM

SCOPe Domain Sequences for d2qgga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qgga2 b.41.1.0 (A:104-181) automated matches {Acinetobacter calcoaceticus [TaxId: 471]}
yywsdlkgltvlglddeeqevnlgqihelfetgandvmvvratpdsidseermipwhkdv
vqrvdleagriyvnwgvd

SCOPe Domain Coordinates for d2qgga2:

Click to download the PDB-style file with coordinates for d2qgga2.
(The format of our PDB-style files is described here.)

Timeline for d2qgga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qgga1