Class b: All beta proteins [48724] (176 folds) |
Fold b.41: PRC-barrel domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
Superfamily b.41.1: PRC-barrel domain [50346] (5 families) |
Family b.41.1.0: automated matches [227212] (1 protein) not a true family |
Protein automated matches [226947] (2 species) not a true protein |
Species Acinetobacter calcoaceticus [TaxId:471] [225297] (1 PDB entry) |
Domain d2qgga2: 2qgg A:104-181 [205811] Other proteins in same PDB: d2qgga1 automated match to d2f1la1 complexed with k, unl |
PDB Entry: 2qgg (more details), 2.4 Å
SCOPe Domain Sequences for d2qgga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qgga2 b.41.1.0 (A:104-181) automated matches {Acinetobacter calcoaceticus [TaxId: 471]} yywsdlkgltvlglddeeqevnlgqihelfetgandvmvvratpdsidseermipwhkdv vqrvdleagriyvnwgvd
Timeline for d2qgga2: