Lineage for d2qgga1 (2qgg A:6-103)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1791673Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1791735Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1792044Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 1792045Protein automated matches [226946] (19 species)
    not a true protein
  7. 1792046Species Acinetobacter calcoaceticus [TaxId:471] [225296] (1 PDB entry)
  8. 1792047Domain d2qgga1: 2qgg A:6-103 [205810]
    Other proteins in same PDB: d2qgga2
    automated match to d2f1la2
    complexed with k, unl

Details for d2qgga1

PDB Entry: 2qgg (more details), 2.4 Å

PDB Description: x-ray structure of the protein q6f7i0 from acinetobacter calcoaceticus amms 248. northeast structural genomics consortium target asr73.
PDB Compounds: (A:) 16S rRNA-processing protein rimM

SCOPe Domain Sequences for d2qgga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qgga1 b.43.3.0 (A:6-103) automated matches {Acinetobacter calcoaceticus [TaxId: 471]}
nvpedriqigqlrsayglngwlwvysntepmsnmfdylpwyietkagwqtvdvkrwkphg
kglvvslkgvsdrtgaeslvasniwiaksqlpkadvde

SCOPe Domain Coordinates for d2qgga1:

Click to download the PDB-style file with coordinates for d2qgga1.
(The format of our PDB-style files is described here.)

Timeline for d2qgga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qgga2