Class b: All beta proteins [48724] (176 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
Protein automated matches [226946] (19 species) not a true protein |
Species Acinetobacter calcoaceticus [TaxId:471] [225296] (1 PDB entry) |
Domain d2qgga1: 2qgg A:6-103 [205810] Other proteins in same PDB: d2qgga2 automated match to d2f1la2 complexed with k, unl |
PDB Entry: 2qgg (more details), 2.4 Å
SCOPe Domain Sequences for d2qgga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qgga1 b.43.3.0 (A:6-103) automated matches {Acinetobacter calcoaceticus [TaxId: 471]} nvpedriqigqlrsayglngwlwvysntepmsnmfdylpwyietkagwqtvdvkrwkphg kglvvslkgvsdrtgaeslvasniwiaksqlpkadvde
Timeline for d2qgga1: