Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (37 species) not a true protein |
Species Cryptosporidium parvum [TaxId:353152] [196400] (5 PDB entries) |
Domain d2qg5d1: 2qg5 D:19-286 [205809] Other proteins in same PDB: d2qg5a2, d2qg5b2, d2qg5d2 automated match to d4eomc_ |
PDB Entry: 2qg5 (more details), 2.3 Å
SCOPe Domain Sequences for d2qg5d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qg5d1 d.144.1.0 (D:19-286) automated matches {Cryptosporidium parvum [TaxId: 353152]} stkgdinqyytlentigrgswgevkiavqkgtrirraakkipkyfvedvdrfkqeieimk sldhpniirlyetfedntdiylvmelctggelfervvhkrvfresdaarimkdvlsavay chklnvahrdlkpenflfltdspdsplklidfglaarfkpgkmmrtkvgtpyyvspqvle glygpecdewsagvmmyvllcgyppfsaptdsevmlkiregtftfpekdwlnvspqaesl irrlltkspkqritslqalehewfekql
Timeline for d2qg5d1:
View in 3D Domains from other chains: (mouse over for more information) d2qg5a1, d2qg5a2, d2qg5b1, d2qg5b2 |