Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
Species Lambda L chain dimer MCG (human) [48930] (18 PDB entries) |
Domain d1mcfb1: 1mcf B:1-111 [20580] Other proteins in same PDB: d1mcfa2, d1mcfb2 |
PDB Entry: 1mcf (more details), 2.7 Å
SCOP Domain Sequences for d1mcfb1:
Sequence, based on SEQRES records: (download)
>d1mcfb1 b.1.1.1 (B:1-111) Immunoglobulin (variable domains of L and H chains) {Lambda L chain dimer MCG (human)} esaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlg
>d1mcfb1 b.1.1.1 (B:1-111) Immunoglobulin (variable domains of L and H chains) {Lambda L chain dimer MCG (human)} psaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlg
Timeline for d1mcfb1: