Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) the constituent families form similar dimers |
Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins) the active site is between the two identical subunits |
Protein automated matches [190072] (22 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225478] (4 PDB entries) |
Domain d2qfxd_: 2qfx D: [205798] automated match to d4hcxb_ complexed with akg, ca, ndp |
PDB Entry: 2qfx (more details), 2.7 Å
SCOPe Domain Sequences for d2qfxd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qfxd_ c.77.1.1 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} fskikvkqpvveldgdemtriiwdkikkklilpyldvdlkyydlsvesrdatsdkitqda aeaikkygvgikcatitpdearvkefnlhkmwkspngtirnilggtvfrepivipriprl vprwekpiiigrhahgdqykatdtlipgpgslelvykpsdpttaqpqtlkvydykgsgva mamyntdesiegfahssfklaidkklnlflstkntilkkydgrfkdifqevyeaqykskf eqlgihyehrliddmvaqmikskggfimalknydgdvqsdivaqgfgslglmtsilvtpd gktfeseaahgtvtrhyrkyqkgeetstnsiasifawsrgllkrgeldntpalckfanil esatlntvqqdgimtkdlalacgnnersayvtteefldavekrlqkeiks
Timeline for d2qfxd_: