SCOP 1.69: Domain d1mcqb1: 1mcq B:1-111

Lineage for d1mcqb1 (1mcq B:1-111)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Human (Homo sapiens), cluster 4 [TaxId:9606] [88539] (23 PDB entries)

8. Domain d1mcqb1: 1mcq B:1-111 [20578]
   Other proteins in same PDB: d1mcqa2, d1mcqb2
   part of the antibody MCG light chain dimer

Details for d1mcqb1

PDB Entry: 1mcq, 2.7 Å

PDB Description: principles and pitfalls in designing site directed peptide ligands

SCOP Domain Sequences for d1mcqb1:

Sequence, based on SEQRES records:

>d1mcqb1 b.1.1.1 (B:1-111) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4}
esaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlg

Sequence, based on observed residues (ATOM records):

>d1mcqb1 b.1.1.1 (B:1-111) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4}
psaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlg

Timeline for d1mcqb1:

• d1mcqb1 first appeared (with stable ids) in SCOP 1.55
  
• d1mcqb1 appears in SCOP 1.67
  
• d1mcqb1 appears in SCOP 1.71
  
• d1mcqb1 appears in the current release, SCOPe 2.08