SCOPe 2.03: Domain d2qe3a_: 2qe3 A:

Lineage for d2qe3a_ (2qe3 A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.0: automated matches [191519] (1 protein)
   not a true family

6. Protein automated matches [190873] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188225] (13 PDB entries)

8. Domain d2qe3a_: 2qe3 A: [205774]
   automated match to d2re9a_
   complexed with cl

Details for d2qe3a_

PDB Entry: 2qe3, 2.5 Å

PDB Description: Crystal structure of human tl1a extracellular domain

PDB Compounds: (A:) TNF superfamily ligand TL1A

SCOPe Domain Sequences for d2qe3a_:

Sequence, based on SEQRES records:

>d2qe3a_ b.22.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adgdkprahltvvrqtptqhfknqfpalhwehelglaftknrmnytnkfllipesgdyfi
ysqvtfrgmtsecseirqagrpnkpdsitvvitkvtdsypeptqllmgtksvcevgsnwf
qpiylgamfslqegdklmvnvsdislvdytkedktffgafll

Sequence, based on observed residues (ATOM records):

>d2qe3a_ b.22.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adgdkprahltvvrqtpfpalhwehelglaftknrmnytnkfllipesgdyfiysqvtfr
gkpdsitvvitkvtdsypeptqllmgtksvcevgsnwfqpiylgamfslqegdklmvnvs
dislvdytkedktffgafll

Timeline for d2qe3a_:

• d2qe3a_ is new in SCOPe 2.03-stable
  
• d2qe3a_ appears in SCOPe 2.04
  
• d2qe3a_ appears in the current release, SCOPe 2.08