Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
Family c.25.1.1: Reductases [52344] (5 proteins) |
Protein Ferredoxin reductase (flavodoxin reductase) [52345] (9 species) |
Species Pseudomonas aeruginosa [TaxId:287] [225369] (2 PDB entries) |
Domain d2qdxa2: 2qdx A:101-258 [205773] Other proteins in same PDB: d2qdxa1 automated match to d1a8pa2 complexed with fad, so4 |
PDB Entry: 2qdx (more details), 1.55 Å
SCOPe Domain Sequences for d2qdxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qdxa2 c.25.1.1 (A:101-258) Ferredoxin reductase (flavodoxin reductase) {Pseudomonas aeruginosa [TaxId: 287]} hddllpgkhlyllstgtgmapflsviqdpetyeryekvilvhgvrwvselayadfitkvl peheyfgdqvkekliyyplvtrepfrnqgrqtdlmrsgklfediglppmnpqddramicg spsmleetsavldsfglkisprmgepgdylierafvek
Timeline for d2qdxa2: