Lineage for d2qdxa1 (2qdx A:2-100)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2402482Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2403031Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2403099Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 2403127Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (9 species)
  7. 2403174Species Pseudomonas aeruginosa [TaxId:287] [225368] (2 PDB entries)
  8. 2403175Domain d2qdxa1: 2qdx A:2-100 [205772]
    Other proteins in same PDB: d2qdxa2
    automated match to d1a8pa1
    complexed with fad, so4

Details for d2qdxa1

PDB Entry: 2qdx (more details), 1.55 Å

PDB Description: P.Aeruginosa Fpr with FAD
PDB Compounds: (A:) Ferredoxin reductase

SCOPe Domain Sequences for d2qdxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qdxa1 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
snlytervlsvhhwndtlfsfkttrnpglrfktgqfvmiglevdgrplmraysiaspnye
ehleffsikvpdgpltsrlqhlkegdelmvsrkptgtlv

SCOPe Domain Coordinates for d2qdxa1:

Click to download the PDB-style file with coordinates for d2qdxa1.
(The format of our PDB-style files is described here.)

Timeline for d2qdxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qdxa2