Class b: All beta proteins [48724] (178 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins) coupled with a NADP-binding domain of alpha/beta class |
Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (9 species) |
Species Pseudomonas aeruginosa [TaxId:287] [225368] (2 PDB entries) |
Domain d2qdxa1: 2qdx A:2-100 [205772] Other proteins in same PDB: d2qdxa2 automated match to d1a8pa1 complexed with fad, so4 |
PDB Entry: 2qdx (more details), 1.55 Å
SCOPe Domain Sequences for d2qdxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qdxa1 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} snlytervlsvhhwndtlfsfkttrnpglrfktgqfvmiglevdgrplmraysiaspnye ehleffsikvpdgpltsrlqhlkegdelmvsrkptgtlv
Timeline for d2qdxa1: