Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species) VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family |
Species Human (Homo sapiens), cluster 4 [TaxId:9606] [88539] (23 PDB entries) |
Domain d1mcba1: 1mcb A:1-111 [20575] Other proteins in same PDB: d1mcba2, d1mcbb2 part of the antibody MCG light chain dimer |
PDB Entry: 1mcb (more details), 2.7 Å
SCOPe Domain Sequences for d1mcba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mcba1 b.1.1.1 (A:1-111) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]} psaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlg
Timeline for d1mcba1: