SCOPe 2.08: Domain d2q4ea1: 2q4e A:6-133,A:305-360

Lineage for d2q4ea1 (2q4e A:6-133,A:305-360)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Probable oxidoreductase At4g09670 [117429] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117430] (2 PDB entries)
   Uniprot Q9SZ83

8. Domain d2q4ea1: 2q4e A:6-133,A:305-360 [205743]
   Other proteins in same PDB: d2q4ea2, d2q4eb2
   automated match to d1ydwa1

Details for d2q4ea1

PDB Entry: 2q4e, 2.49 Å

PDB Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At4g09670

PDB Compounds: (A:) Probable oxidoreductase At4g09670

SCOPe Domain Sequences for d2q4ea1:

Sequence, based on SEQRES records:

>d2q4ea1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qirigvmgcadiarkvsraihlapnatisgvasrslekakafatannypestkihgsyes
lledpeidalyvplptslhvewaikaaekgkhillekpvamnvtefdkivdaceangvqi
mdgtmwvhXpqeacmvrefarlvgeiknngakpdgywpsisrktqlvvdavkesvdknyq
qisls

Sequence, based on observed residues (ATOM records):

>d2q4ea1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qirigvmgcadiarkvsraihlapnatisgvasrslekakafatannypestkihgsyes
lledpeidalyvplptslhvewaikaaekgkhillekpvamnvtefdkivdaceangvqi
mdgtmwvhXpqeacmvrefarlvywpsisrktqlvvdavkesvdknyqqisls

Timeline for d2q4ea1:

• d2q4ea1 first appeared in SCOPe 2.03
  
• d2q4ea1 appears in SCOPe 2.07