SCOP 1.63: Domain d1mckb1: 1mck B:1-111

Lineage for d1mckb1 (1mck B:1-111)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Lambda L chain dimer MCG (human) [48930] (18 PDB entries)

8. Domain d1mckb1: 1mck B:1-111 [20574]
   Other proteins in same PDB: d1mcka2, d1mckb2
   complexed with nh2

Details for d1mckb1

PDB Entry: 1mck, 2.7 Å

PDB Description: principles and pitfalls in designing site directed peptide ligands

SCOP Domain Sequences for d1mckb1:

Sequence, based on SEQRES records:

>d1mckb1 b.1.1.1 (B:1-111) Immunoglobulin (variable domains of L and H chains) {Lambda L chain dimer MCG (human)}
esaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlg

Sequence, based on observed residues (ATOM records):

>d1mckb1 b.1.1.1 (B:1-111) Immunoglobulin (variable domains of L and H chains) {Lambda L chain dimer MCG (human)}
psaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlg

Timeline for d1mckb1:

• d1mckb1 first appeared (with stable ids) in SCOP 1.55
  
• d1mckb1 appears in SCOP 1.61
  
• d1mckb1 appears in SCOP 1.65
  
• d1mckb1 appears in the current release, SCOPe 2.08