Lineage for d2q32a_ (2q32 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732616Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2732617Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2732860Family a.132.1.0: automated matches [191333] (1 protein)
    not a true family
  6. 2732861Protein automated matches [190172] (9 species)
    not a true protein
  7. 2732867Species Human (Homo sapiens) [TaxId:9606] [225276] (7 PDB entries)
  8. 2732880Domain d2q32a_: 2q32 A: [205738]
    automated match to d1wova1
    complexed with oxn

Details for d2q32a_

PDB Entry: 2q32 (more details), 2.4 Å

PDB Description: crystal structure of human heme oxygenase-2 c127a (ho-2)
PDB Compounds: (A:) Heme oxygenase 2

SCOPe Domain Sequences for d2q32a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q32a_ a.132.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rmadlsellkegtkeahdraentqfvkdflkgnikkelfklattalyftysaleeemern
kdhpafaplyfpmelhrkealtkdmeyffgenweeqvqapkaaqkyverihyigqnepel
lvahaytrymgdlsggqvlkkvaqralklpstgegtqfylfenvdnaqqfkqlyrarmna
ldlnmktkeriveeankafeynmqifneldqag

SCOPe Domain Coordinates for d2q32a_:

Click to download the PDB-style file with coordinates for d2q32a_.
(The format of our PDB-style files is described here.)

Timeline for d2q32a_: