Lineage for d2q2cd_ (2q2c D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915548Species Geobacillus stearothermophilus [TaxId:1422] [225397] (10 PDB entries)
  8. 2915564Domain d2q2cd_: 2q2c D: [205729]
    automated match to d2xhdb_
    complexed with gol, his, so4

Details for d2q2cd_

PDB Entry: 2q2c (more details), 2.35 Å

PDB Description: crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus
PDB Compounds: (D:) ArtJ

SCOPe Domain Sequences for d2q2cd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q2cd_ c.94.1.0 (D:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
kkvvvgtdaafapfeymqkgkivgfdvdlldavmkaagldyelknigwdplfaslqskev
dmgisgititderkqsydfsdpyfeatqvilvkqgspvknaldlkgktigvqnattgqea
aeklfgkgphikkfettvvaimellnggvdavitdnavaneyvknnpnkklqviedpknf
aseyygmifpknselkakvdealknvinsgkyteiykkwfgkepkldrlkq

SCOPe Domain Coordinates for d2q2cd_:

Click to download the PDB-style file with coordinates for d2q2cd_.
(The format of our PDB-style files is described here.)

Timeline for d2q2cd_: