SCOPe 2.06: Domain d2q1wa_: 2q1w A:

Lineage for d2q1wa_ (2q1w A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Bordetella bronchiseptica [TaxId:518] [225344] (8 PDB entries)

8. Domain d2q1wa_: 2q1w A: [205719]
   Other proteins in same PDB: d2q1wb2, d2q1wc2
   automated match to d1e6ua_
   complexed with nad

Details for d2q1wa_

PDB Entry: 2q1w, 2.19 Å

PDB Description: Crystal structure of the Bordetella bronchiseptica enzyme WbmH in complex with NAD+

PDB Compounds: (A:) Putative nucleotide sugar epimerase/ dehydratase

SCOPe Domain Sequences for d2q1wa_:

Sequence; same for both SEQRES and ATOM records:

>d2q1wa_ c.2.1.0 (A:) automated matches {Bordetella bronchiseptica [TaxId: 518]}
mkkvfitgicgqigshiaelllergdkvvgidnfatgrrehlkdhpnltfvegsiadhal
vnqligdlqpdavvhtaasykdpddwyndtltncvggsnvvqaakknnvgrfvyfqtalc
ygvkpiqqpvrldhprnpanssyaisksanedyleysgldfvtfrlanvvgprnvsgplp
iffqrlsegkkcfvtkarrdfvfvkdlaratvravdgvghgayhfssgtdvaikelydav
veamalpsypepeirelgpddapsilldpsrtiqdfgkieftplketvaaavayfreygv

Timeline for d2q1wa_:

• d2q1wa_ first appeared in SCOPe 2.03
  
• d2q1wa_ appears in SCOPe 2.05
  
• d2q1wa_ appears in SCOPe 2.07
  
• d2q1wa_ appears in the current release, SCOPe 2.08