SCOPe 2.04: Domain d2q0hb_: 2q0h B:

Lineage for d2q0hb_ (2q0h B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (79 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [188756] (8 PDB entries)

8. Domain d2q0hb_: 2q0h B: [205714]
   automated match to d1b0ua_
   complexed with adp, gol, mg

Details for d2q0hb_

PDB Entry: 2q0h, 2.2 Å

PDB Description: abc protein artp in complex with adp/mg2+, atp-gamma-s hydrolyzed

PDB Compounds: (B:) ArtP

SCOPe Domain Sequences for d2q0hb_:

Sequence; same for both SEQRES and ATOM records:

>d2q0hb_ c.37.1.0 (B:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
lqmidvhqlkksfgslevlkginvhiregevvvvigpsgsgkstflrclnlledfdegei
iidginlkakdtnlnkvreevgmvfqrfnlfphmtvlnnitlapmkvrkwprekaeakam
elldkvglkdkahaypdslsggqaqrvaiaralamepkimlfdeptsaldpemvgevlsv
mkqlanegmtmvvvthemgfarevgdrvlfmdggyiieegkpedlfdrpqhertkaflsk
vf

Timeline for d2q0hb_:

• d2q0hb_ first appeared in SCOPe 2.03
  
• d2q0hb_ appears in SCOPe 2.05
  
• d2q0hb_ appears in the current release, SCOPe 2.08, called d2q0hb1