Lineage for d2pzma_ (2pzm A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1580347Species Bordetella bronchiseptica [TaxId:518] [225344] (6 PDB entries)
  8. 1580351Domain d2pzma_: 2pzm A: [205707]
    automated match to d3enkb_
    complexed with nad, so4, udp

Details for d2pzma_

PDB Entry: 2pzm (more details), 2 Å

PDB Description: Crystal structure of the Bordetella bronchiseptica enzyme WbmG in complex with NAD and UDP
PDB Compounds: (A:) Putative nucleotide sugar epimerase/ dehydratase

SCOPe Domain Sequences for d2pzma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pzma_ c.2.1.0 (A:) automated matches {Bordetella bronchiseptica [TaxId: 518]}
lvprgshmrilitggagclgsnliehwlpqgheilvidnfatgkrevlppvaglsviegs
vtdagllerafdsfkpthvvhsaaaykdpddwaedaatnvqgsinvakaaskagvkrlln
fqtalcygrpatvpipidsptapftsygisktageaflmmsdvpvvslrlanvtgprlai
gpiptfykrlkagqkcfcsdtvrdfldmsdflaiadlslqegrptgvfnvstgeghsike
vfdvvldyvgatlaepvpvvapgaddvpsvvldpsktetefgwkakvdfkdtitgqlawy
dkygvtdifshlsapk

SCOPe Domain Coordinates for d2pzma_:

Click to download the PDB-style file with coordinates for d2pzma_.
(The format of our PDB-style files is described here.)

Timeline for d2pzma_: