Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Bordetella bronchiseptica [TaxId:518] [225344] (8 PDB entries) |
Domain d2pzma1: 2pzm A:1-309 [205707] Other proteins in same PDB: d2pzma2, d2pzmb2 automated match to d3enkb_ complexed with nad, so4, udp |
PDB Entry: 2pzm (more details), 2 Å
SCOPe Domain Sequences for d2pzma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pzma1 c.2.1.0 (A:1-309) automated matches {Bordetella bronchiseptica [TaxId: 518]} mrilitggagclgsnliehwlpqgheilvidnfatgkrevlppvaglsviegsvtdagll erafdsfkpthvvhsaaaykdpddwaedaatnvqgsinvakaaskagvkrllnfqtalcy grpatvpipidsptapftsygisktageaflmmsdvpvvslrlanvtgprlaigpiptfy krlkagqkcfcsdtvrdfldmsdflaiadlslqegrptgvfnvstgeghsikevfdvvld yvgatlaepvpvvapgaddvpsvvldpsktetefgwkakvdfkdtitgqlawydkygvtd ifshlsapk
Timeline for d2pzma1: