SCOPe 2.03: Domain d2pzka_: 2pzk A:

Lineage for d2pzka_ (2pzk A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (159 species)
   not a true protein

7. Species Bordetella bronchiseptica [TaxId:518] [225344] (4 PDB entries)

8. Domain d2pzka_: 2pzk A: [205703]
   automated match to d3enkb_
   complexed with mg, nad

Details for d2pzka_

PDB Entry: 2pzk, 2.1 Å

PDB Description: Crystal structure of the Bordetella bronchiseptica enzyme WbmG in complex with NAD

PDB Compounds: (A:) Putative nucleotide sugar epimerase/ dehydratase

SCOPe Domain Sequences for d2pzka_:

Sequence; same for both SEQRES and ATOM records:

>d2pzka_ c.2.1.0 (A:) automated matches {Bordetella bronchiseptica [TaxId: 518]}
shmrilitggagclgsnliehwlpqgheilvidnfatgkrevlppvaglsviegsvtdag
llerafdsfkpthvvhsaaaykdpddwaedaatnvqgsinvakaaskagvkrllnfqtal
cygrpatvpipidsptapftsygisktageaflmmsdvpvvslrlanvtgprlaigpipt
fykrlkagqkcfcsdtvrdfldmsdflaiadlslqegrptgvfnvstgeghsikevfdvv
ldyvgatlaepvpvvapgaddvpsvvldpsktetefgwkakvdfkdtitgqlawydkygv
tdifshlsap

Timeline for d2pzka_:

• d2pzka_ is new in SCOPe 2.03-stable
  
• d2pzka_ appears in SCOPe 2.04
  
• d2pzka_ appears in the current release, SCOPe 2.08, called d2pzka1