SCOPe 2.08: Domain d2pyfb1: 2pyf B:1-113

Lineage for d2pyfb1 (2pyf B:1-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d2pyfb1: 2pyf B:1-113 [205694]
   Other proteins in same PDB: d2pyfa1, d2pyfa2, d2pyfb2
   automated match to d1qrne1
   complexed with pg4, pge, so4

Details for d2pyfb1

PDB Entry: 2pyf, 2.2 Å

PDB Description: Crystal Structures of High Affinity Human T-Cell Receptors Bound to pMHC RevealNative Diagonal Binding Geometry Unbound TCR Clone 5-1

PDB Compounds: (B:) T-cell receptor, beta chain

SCOPe Domain Sequences for d2pyfb1:

Sequence; same for both SEQRES and ATOM records:

>d2pyfb1 b.1.1.1 (B:1-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagttdqgevpn
gynvsrstiedfplrllsaapsqtsvyfcassylgntgelffgegsrltvled

Timeline for d2pyfb1:

• d2pyfb1 first appeared in SCOPe 2.03
  
• d2pyfb1 appears in SCOPe 2.07