Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
Domain d2pyfb1: 2pyf B:1-113 [205694] Other proteins in same PDB: d2pyfa1, d2pyfa2, d2pyfb2 automated match to d1qrne1 complexed with pg4, pge, so4 |
PDB Entry: 2pyf (more details), 2.2 Å
SCOPe Domain Sequences for d2pyfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pyfb1 b.1.1.1 (B:1-113) automated matches {Human (Homo sapiens) [TaxId: 9606]} gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagttdqgevpn gynvsrstiedfplrllsaapsqtsvyfcassylgntgelffgegsrltvled
Timeline for d2pyfb1: