SCOPe 2.05: Domain d2pwfa1: 2pwf A:3-478

Lineage for d2pwfa1 (2pwf A:3-478)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein automated matches [190099] (22 species)
   not a true protein

7. Species Pseudomonas mesoacidophila [TaxId:265293] [224875] (9 PDB entries)

8. Domain d2pwfa1: 2pwf A:3-478 [205672]
   Other proteins in same PDB: d2pwfa2, d2pwfb2, d2pwfc2, d2pwfd2
   automated match to d1m53a2
   complexed with bgc, ca; mutant

Details for d2pwfa1

PDB Entry: 2pwf, 1.8 Å

PDB Description: crystal structure of the mutb d200a mutant in complex with glucose

PDB Compounds: (A:) Sucrose isomerase

SCOPe Domain Sequences for d2pwfa1:

Sequence; same for both SEQRES and ATOM records:

>d2pwfa1 c.1.8.1 (A:3-478) automated matches {Pseudomonas mesoacidophila [TaxId: 265293]}
gapwwksavfyqvyprsfkdtngdgigdfkgltekldylkglgidaiwinphyaspntdn
gydisdyrevmkeygtmedfdrlmaelkkrgmrlmvdvvinhssdqhewfkssraskdnp
yrdyyfwrdgkdghepnnypsffggsawekdpvtgqyylhyfgrqqpdlnwdtpklreel
yamlrfwldkgvsgmrfatvatysktpgfpdltpeqmknfaeaytqgpnlhrylqemhek
vfdhydavtageifgaplnqvplfidsrrkeldmaftfdlirydraldrwhtiprtladf
rqtidkvdaiageygwntfflgnhdnpravshfgddrpqwreasakalatvtltqrgtpf
ifqgdelgmtnypfktlqdfddievkgffqdyvetgkataeelltnvaltsrdnartpfq
wddsanagfttgkpwlkvnpnyteinaareigdpksvysfyrnlisirhetpalst

Timeline for d2pwfa1:

• d2pwfa1 first appeared in SCOPe 2.03
  
• d2pwfa1 appears in SCOPe 2.04
  
• d2pwfa1 appears in SCOPe 2.06
  
• d2pwfa1 appears in the current release, SCOPe 2.08