Lineage for d2mcg11 (2mcg 1:1-111)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 931241Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 931276Species Human (Homo sapiens), cluster 4 [TaxId:9606] [88539] (23 PDB entries)
  8. 931285Domain d2mcg11: 2mcg 1:1-111 [20567]
    Other proteins in same PDB: d2mcg12, d2mcg22
    part of the antibody MCG light chain dimer

Details for d2mcg11

PDB Entry: 2mcg (more details), 2 Å

PDB Description: three-dimensional structure of a light chain dimer crystallized in water. conformational flexibility of a molecule in two crystal forms
PDB Compounds: (1:) immunoglobulin lambda dimer mcg (light chain)

SCOPe Domain Sequences for d2mcg11:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mcg11 b.1.1.1 (1:1-111) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]}
esaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlg

SCOPe Domain Coordinates for d2mcg11:

Click to download the PDB-style file with coordinates for d2mcg11.
(The format of our PDB-style files is described here.)

Timeline for d2mcg11:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mcg12