Lineage for d2mcg11 (2mcg 1:1-111)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7965Species Lambda L chain dimer MCG (human) [48930] (18 PDB entries)
  8. 7968Domain d2mcg11: 2mcg 1:1-111 [20567]
    Other proteins in same PDB: d2mcg12, d2mcg22

Details for d2mcg11

PDB Entry: 2mcg (more details), 2 Å

PDB Description: three-dimensional structure of a light chain dimer crystallized in water. conformational flexibility of a molecule in two crystal forms

SCOP Domain Sequences for d2mcg11:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mcg11 b.1.1.1 (1:1-111) Immunoglobulin (variable domains of L and H chains) {Lambda L chain dimer MCG (human)}
esaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlg

SCOP Domain Coordinates for d2mcg11:

Click to download the PDB-style file with coordinates for d2mcg11.
(The format of our PDB-style files is described here.)

Timeline for d2mcg11:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mcg12