Lineage for d1dclb1 (1dcl B:1-111)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 103019Species Lambda L chain dimer MCG (human) [48930] (18 PDB entries)
  8. 103021Domain d1dclb1: 1dcl B:1-111 [20566]
    Other proteins in same PDB: d1dcla2, d1dclb2

Details for d1dclb1

PDB Entry: 1dcl (more details), 2.3 Å

PDB Description: mcg, a lambda v type light-chain dimer (bence-jones protein), crystallized from ammonium sulfate

SCOP Domain Sequences for d1dclb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dclb1 b.1.1.1 (B:1-111) Immunoglobulin (variable domains of L and H chains) {Lambda L chain dimer MCG (human)}
psaltqppsasgslgqsvtisctgtssnvggynyvswyqqhagkapkviiyevnkrpsgv
pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlg

SCOP Domain Coordinates for d1dclb1:

Click to download the PDB-style file with coordinates for d1dclb1.
(The format of our PDB-style files is described here.)

Timeline for d1dclb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dclb2