SCOP 1.73: Domain d1mcoh1: 1mco H:1-117

Lineage for d1mcoh1 (1mco H:1-117)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 2.2 [TaxId:9606] [88546] (1 PDB entry)

8. Domain d1mcoh1: 1mco H:1-117 [20564]
   Other proteins in same PDB: d1mcoh2, d1mcoh3, d1mcoh4, d1mcol1, d1mcol2
   part of intact antibody MCG
   complexed with fuc, gal, man, nag, sia

Details for d1mcoh1

PDB Entry: 1mco, 3.2 Å

PDB Description: three-dimensional structure of a human immunoglobulin with a hinge deletion

PDB Compounds: (H:) igg1 mcg intact antibody (heavy chain)

SCOP Domain Sequences for d1mcoh1:

Sequence; same for both SEQRES and ATOM records:

>d1mcoh1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.2 [TaxId: 9606]}
plvlqesgpglvkpsealsltctvsgdsintilyywswirqppgkglewigyiyysgsty
gnpslksrvtisvntsknqfysklssvtaadtavyycarvplvvnpwgqgtlvtvss

Timeline for d1mcoh1:

• d1mcoh1 first appeared (with stable ids) in SCOP 1.55
  
• d1mcoh1 appears in SCOP 1.71
  
• d1mcoh1 appears in SCOP 1.75
  
• d1mcoh1 appears in the current release, SCOPe 2.08