Lineage for d1mcoh1 (1mco H:1-117)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52646Species Intact antibody (lambda) MCG (human) [48929] (1 PDB entry)
  8. 52647Domain d1mcoh1: 1mco H:1-117 [20564]
    Other proteins in same PDB: d1mcoh2, d1mcoh3, d1mcoh4, d1mcol2

Details for d1mcoh1

PDB Entry: 1mco (more details), 3.2 Å

PDB Description: three-dimensional structure of a human immunoglobulin with a hinge deletion

SCOP Domain Sequences for d1mcoh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mcoh1 b.1.1.1 (H:1-117) Immunoglobulin (variable domains of L and H chains) {Intact antibody (lambda) MCG (human)}
plvlqesgpglvkpsealsltctvsgdsintilyywswirqppgkglewigyiyysgsty
gnpslksrvtisvntsknqfysklssvtaadtavyycarvplvvnpwgqgtlvtvss

SCOP Domain Coordinates for d1mcoh1:

Click to download the PDB-style file with coordinates for d1mcoh1.
(The format of our PDB-style files is described here.)

Timeline for d1mcoh1: