Lineage for d2psnc2 (2psn C:140-433)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1573508Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1573509Family c.1.11.1: Enolase [51605] (2 proteins)
    automatically mapped to Pfam PF00113
  6. 1573588Protein automated matches [226973] (4 species)
    not a true protein
  7. 1573594Species Human (Homo sapiens) [TaxId:9606] [225520] (3 PDB entries)
  8. 1573599Domain d2psnc2: 2psn C:140-433 [205633]
    Other proteins in same PDB: d2psna1, d2psnb1, d2psnc1, d2psnd1
    automated match to d1pdza1
    complexed with mg, po4

Details for d2psnc2

PDB Entry: 2psn (more details), 2.2 Å

PDB Description: Crystal structure of enolase1
PDB Compounds: (C:) Alpha-enolase

SCOPe Domain Sequences for d2psnc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2psnc2 c.1.11.1 (C:140-433) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sevilpvpafnvinggshagnklamqefmilpvgaanfreamrigaevyhnlknvikeky
gkdatnvgdeggfapnilenkeglellktaigkagytdkvvigmdvaaseffrsgkydld
fkspddpsryispdqladlyksfikdypvvsiedpfdqddwgawqkftasagiqvvgddl
tvtnpkriakavnekscnclllkvnqigsvteslqacklaqangwgvmvshrsgetedtf
iadlvvglctgqiktgapcrserlakynqllrieeelgskakfagrnfrnplak

SCOPe Domain Coordinates for d2psnc2:

Click to download the PDB-style file with coordinates for d2psnc2.
(The format of our PDB-style files is described here.)

Timeline for d2psnc2: