Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.1: Enolase [51605] (2 proteins) automatically mapped to Pfam PF00113 |
Protein automated matches [226973] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225520] (3 PDB entries) |
Domain d2psnc2: 2psn C:140-433 [205633] Other proteins in same PDB: d2psna1, d2psnb1, d2psnc1, d2psnd1 automated match to d1pdza1 complexed with mg, po4 |
PDB Entry: 2psn (more details), 2.2 Å
SCOPe Domain Sequences for d2psnc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2psnc2 c.1.11.1 (C:140-433) automated matches {Human (Homo sapiens) [TaxId: 9606]} sevilpvpafnvinggshagnklamqefmilpvgaanfreamrigaevyhnlknvikeky gkdatnvgdeggfapnilenkeglellktaigkagytdkvvigmdvaaseffrsgkydld fkspddpsryispdqladlyksfikdypvvsiedpfdqddwgawqkftasagiqvvgddl tvtnpkriakavnekscnclllkvnqigsvteslqacklaqangwgvmvshrsgetedtf iadlvvglctgqiktgapcrserlakynqllrieeelgskakfagrnfrnplak
Timeline for d2psnc2: