SCOPe 2.06: Domain d2psnb1: 2psn B:1-139

Lineage for d2psnb1 (2psn B:1-139)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (88 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225519] (3 PDB entries)

8. Domain d2psnb1: 2psn B:1-139 [205630]
   Other proteins in same PDB: d2psna2, d2psnb2, d2psnc2, d2psnd2
   automated match to d1pdza2
   complexed with mg, po4

Details for d2psnb1

PDB Entry: 2psn, 2.2 Å

PDB Description: Crystal structure of enolase1

PDB Compounds: (B:) Alpha-enolase

SCOPe Domain Sequences for d2psnb1:

Sequence; same for both SEQRES and ATOM records:

>d2psnb1 d.54.1.0 (B:1-139) automated matches {Human (Homo sapiens) [TaxId: 9606]}
silkihareifdsrgnptvevdlftskglfraavpsgastgiyealelrdndktrymgkg
vskavehinktiapalvskklnvteqekidklmiemdgtenkskfganailgvslavcka
gavekgvplyrhiadlagn

Timeline for d2psnb1:

• d2psnb1 first appeared in SCOPe 2.03
  
• d2psnb1 appears in SCOPe 2.05
  
• d2psnb1 appears in SCOPe 2.07
  
• d2psnb1 appears in the current release, SCOPe 2.08